LCP1 antibody (70R-2221)

Rabbit polyclonal LCP1 antibody

Synonyms Polyclonal LCP1 antibody, Anti-LCP1 antibody, LC64P antibody, L-PLASTIN antibody, LCP-1 antibody, L-Plastin antibody, LCP 1, LCP-1, CP64 antibody, FLJ25423 antibody, LCP1, Lymphocyte Cytosolic Protein 1 antibody, FLJ26114 antibody, PLS2 antibody, DKFZp781A23186 antibody, LCP 1 antibody, FLJ39956 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK
Assay Information LCP1 Blocking Peptide, catalog no. 33R-2929, is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody

Western Blot analysis using LCP1 antibody (70R-2221)

LCP1 antibody (70R-2221) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using LCP1 antibody (70R-2221) | LCP1 antibody (70R-2221) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors