LDB3 antibody (70R-1141)

Rabbit polyclonal LDB3 antibody raised against the N terminal of LDB3

Synonyms Polyclonal LDB3 antibody, Anti-LDB3 antibody, KIAA01613 antibody, Lim Domain Binding 3 antibody, LDB 3 antibody, LDB-3 antibody, ORACLE antibody, CYPHER antibody, LDB3, KIAA0613 antibody, LDB 3, ZASP antibody, PDLIM6 antibody, LDB-3
Specificity LDB3 antibody was raised against the N terminal of LDB3
Cross Reactivity Human,Mouse
Applications WB
Immunogen LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS
Assay Information LDB3 Blocking Peptide, catalog no. 33R-7412, is also available for use as a blocking control in assays to test for specificity of this LDB3 antibody


Western Blot analysis using LDB3 antibody (70R-1141)

LDB3 antibody (70R-1141) used at 0.625 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LDB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LDB3 antibody (70R-1141) | LDB3 antibody (70R-1141) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors