LDHAL6B antibody (70R-3958)

Rabbit polyclonal LDHAL6B antibody raised against the middle region of LDHAL6B

Synonyms Polyclonal LDHAL6B antibody, Anti-LDHAL6B antibody, LDHL antibody, LDHAL6 antibody, Lactate Dehydrogenase A-Like 6B antibody
Specificity LDHAL6B antibody was raised against the middle region of LDHAL6B
Cross Reactivity Human
Applications WB
Immunogen LDHAL6B antibody was raised using the middle region of LDHAL6B corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA
Assay Information LDHAL6B Blocking Peptide, catalog no. 33R-8500, is also available for use as a blocking control in assays to test for specificity of this LDHAL6B antibody


Western Blot analysis using LDHAL6B antibody (70R-3958)

LDHAL6B antibody (70R-3958) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDHAL6B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LDH protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LDHAL6B antibody (70R-3958) | LDHAL6B antibody (70R-3958) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors