LDHB antibody (70R-3734)

Rabbit polyclonal LDHB antibody raised against the C terminal of LDHB

Synonyms Polyclonal LDHB antibody, Anti-LDHB antibody, TRG-5 antibody, LDH-H antibody, Lactate Dehydrogenase B antibody
Specificity LDHB antibody was raised against the C terminal of LDHB
Cross Reactivity Human
Applications WB
Immunogen LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Assay Information LDHB Blocking Peptide, catalog no. 33R-6625, is also available for use as a blocking control in assays to test for specificity of this LDHB antibody

Images

Immunohistochemical staining using LDHB antibody (70R-3734)

LDHB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDHB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using LDHB antibody (70R-3734) | LDHB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using LDHB antibody (70R-3734) | LDHB antibody (70R-3734) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors