LEFTY1 antibody (70R-6222)

Rabbit polyclonal LEFTY1 antibody raised against the N terminal of LEFTY1

Synonyms Polyclonal LEFTY1 antibody, Anti-LEFTY1 antibody, LEFTY 1, LEFTY-1 antibody, Left-Right Determination Factor 1 antibody, LEFTY 1 antibody, LEFTB antibody, LEFTY1, LEFTY-1, LEFTYB antibody
Specificity LEFTY1 antibody was raised against the N terminal of LEFTY1
Cross Reactivity Human
Applications WB
Immunogen LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
Assay Information LEFTY1 Blocking Peptide, catalog no. 33R-6338, is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody


Western blot analysis using LEFTY1 antibody (70R-6222)

Recommended LEFTY1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LEFTY1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using LEFTY1 antibody (70R-6222) | Recommended LEFTY1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors