LEFTY2 antibody (70R-6228)

Rabbit polyclonal LEFTY2 antibody raised against the N terminal of LEFTY2

Synonyms Polyclonal LEFTY2 antibody, Anti-LEFTY2 antibody, LEFTY2, MGC46222 antibody, TGFB4 antibody, LEFTY 2 antibody, LEFTY 2, Left-Right Determination Factor 2 antibody, LEFTYA antibody, LEFTY-2 antibody, EBAF antibody, LEFTA antibody, LEFTY-2
Specificity LEFTY2 antibody was raised against the N terminal of LEFTY2
Cross Reactivity Human
Applications WB
Immunogen LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
Assay Information LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody

Images

Western Blot analysis using LEFTY2 antibody (70R-6228)

LEFTY2 antibody (70R-6228) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LEFTY2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LEFTY2 antibody (70R-6228) | LEFTY2 antibody (70R-6228) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors