LEMD2 antibody (70R-6307)

Rabbit polyclonal LEMD2 antibody raised against the middle region of LEMD2

Synonyms Polyclonal LEMD2 antibody, Anti-LEMD2 antibody, Lem Domain Containing 2 antibody, LEMD-2 antibody, LEMD 2, LEMD 2 antibody, dJ482C21.1 antibody, LEMD-2, LEMD2
Specificity LEMD2 antibody was raised against the middle region of LEMD2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE
Assay Information LEMD2 Blocking Peptide, catalog no. 33R-8774, is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody

Images

Western Blot analysis using LEMD2 antibody (70R-6307)

LEMD2 antibody (70R-6307) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LEMD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEMD2 is involved in nuclear structure organization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LEMD2 antibody (70R-6307) | LEMD2 antibody (70R-6307) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors