LENG4 antibody (70R-7358)

Rabbit polyclonal LENG4 antibody raised against the C terminal Of Leng4

Synonyms Polyclonal LENG4 antibody, Anti-LENG4 antibody, LENG-4, LENG 4 antibody, LENG4, LENG 4, BB1 antibody, LENG-4 antibody
Specificity LENG4 antibody was raised against the C terminal Of Leng4
Cross Reactivity Human
Applications WB
Immunogen LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
Assay Information LENG4 Blocking Peptide, catalog no. 33R-10038, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody

Images

Western Blot analysis using LENG4 antibody (70R-7358)

LENG4 antibody (70R-7358) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LENG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LENG4 antibody (70R-7358) | LENG4 antibody (70R-7358) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors