Leptin antibody (70R-6221)

Rabbit polyclonal Leptin antibody raised against the N terminal of LEP

Synonyms Polyclonal Leptin antibody, Anti-Leptin antibody, OBS antibody, LEP antibody, OB antibody
Specificity Leptin antibody was raised against the N terminal of LEP
Cross Reactivity Human,Mouse
Applications WB
Immunogen Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
Assay Information Leptin Blocking Peptide, catalog no. 33R-6105, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Images

Immunohistochemical staining using Leptin antibody (70R-6221)

Leptin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LEP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Leptin antibody (70R-6221) | Leptin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Leptin antibody (70R-6221) | Leptin antibody (70R-6221) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors