Leptin antibody (70R-6223)

Rabbit polyclonal Leptin antibody raised against the middle region of LEP

Synonyms Polyclonal Leptin antibody, Anti-Leptin antibody, LEP antibody, OB antibody, OBS antibody
Specificity Leptin antibody was raised against the middle region of LEP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Leptin antibody was raised using the middle region of LEP corresponding to a region with amino acids LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM
Assay Information Leptin Blocking Peptide, catalog no. 33R-5033, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Images

Immunofluorescent staining using Leptin antibody (70R-6223)

Leptin antibody used at a concentration of 10 ug/ml to detect neuronal processes in the hypothalamus of rodent brain (red). Nuclei were stained with DAPI.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LEP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using Leptin antibody (70R-6223) | Leptin antibody used at a concentration of 10 ug/ml to detect neuronal processes in the hypothalamus of rodent brain (red). Nuclei were stained with DAPI.
  • Western Blot analysis using Leptin antibody (70R-6223) | Leptin antibody (70R-6223) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using Leptin antibody (70R-6223) | Leptin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors