LETM2 antibody (70R-3573)

Rabbit polyclonal LETM2 antibody raised against the N terminal of LETM2

Synonyms Polyclonal LETM2 antibody, Anti-LETM2 antibody, LETM 2 antibody, FLJ25409 antibody, LETM 2, LETM2, LETM-2, LETM-2 antibody, Leucine Zipper-Ef-Hand Containing Transmembrane Protein 2 antibody
Specificity LETM2 antibody was raised against the N terminal of LETM2
Cross Reactivity Human
Applications WB
Immunogen LETM2 antibody was raised using the N terminal of LETM2 corresponding to a region with amino acids KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
Assay Information LETM2 Blocking Peptide, catalog no. 33R-4578, is also available for use as a blocking control in assays to test for specificity of this LETM2 antibody

Images

Western Blot analysis using LETM2 antibody (70R-3573)

LETM2 antibody (70R-3573) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LETM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LETM2 antibody (70R-3573) | LETM2 antibody (70R-3573) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors