LGALS14 antibody (70R-3934)

Rabbit polyclonal LGALS14 antibody raised against the N terminal of LGALS14

Synonyms Polyclonal LGALS14 antibody, Anti-LGALS14 antibody, PPL13 antibody, LGALS 14 antibody, Lectin Galactoside-Binding Soluble 14 antibody, MGC22235 antibody, LGALS14, CLC2 antibody, LGALS 14, LGALS-14, LGALS-14 antibody
Specificity LGALS14 antibody was raised against the N terminal of LGALS14
Cross Reactivity Human
Applications WB
Immunogen LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
Assay Information LGALS14 Blocking Peptide, catalog no. 33R-6502, is also available for use as a blocking control in assays to test for specificity of this LGALS14 antibody


Western Blot analysis using LGALS14 antibody (70R-3934)

LGALS14 antibody (70R-3934) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LGALS14 antibody (70R-3934) | LGALS14 antibody (70R-3934) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors