LGALS3BP antibody (70R-6085)

Rabbit polyclonal LGALS3BP antibody raised against the middle region of LGALS3BP

Synonyms Polyclonal LGALS3BP antibody, Anti-LGALS3BP antibody, 90K antibody, MAC-2-BP antibody, LGALS3, LGALS-3, Lectin Galactoside-Binding Soluble 3 Binding Protein antibody, LGALS 3 antibody, LGALS 3, LGALS-3 antibody
Specificity LGALS3BP antibody was raised against the middle region of LGALS3BP
Cross Reactivity Human,Mouse
Applications WB
Immunogen LGALS3BP antibody was raised using the middle region of LGALS3BP corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
Assay Information LGALS3BP Blocking Peptide, catalog no. 33R-6776, is also available for use as a blocking control in assays to test for specificity of this LGALS3BP antibody

Images

Western Blot analysis using LGALS3BP antibody (70R-6085)

LGALS3BP antibody (70R-6085) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS3BP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LGALS3BP antibody (70R-6085) | LGALS3BP antibody (70R-6085) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors