LGALS8 antibody (70R-2241)

Rabbit polyclonal LGALS8 antibody

Synonyms Polyclonal LGALS8 antibody, Anti-LGALS8 antibody, Gal-8 antibody, LGALS 8, Galectin 8 antibody, LGALS8, Lectin Galactoside-Binding Soluble 8 antibody, LGALS-8 antibody, Po66-CBP antibody, LGALS 8 antibody, LGALS-8, PCTA1 antibody, PCTA-1 antibody
Cross Reactivity Human
Applications WB
Immunogen LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
Assay Information LGALS8 Blocking Peptide, catalog no. 33R-3014, is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody

Images

Western Blot analysis using LGALS8 antibody (70R-2241)

LGALS8 antibody (70R-2241) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LGALS8 antibody (70R-2241) | LGALS8 antibody (70R-2241) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors