LGALS9 antibody (70R-5743)

Rabbit polyclonal LGALS9 antibody

Synonyms Polyclonal LGALS9 antibody, Anti-LGALS9 antibody, MGC125973 antibody, ECALECTIN antibody, MGC117375 antibody, HUAT antibody, LGALS 9, LGALS 9 antibody, galectin-9 antibody, MGC125974 antibody, LGALS-9 antibody, Galectin 9 antibody, LGALS9, LGALS-9, Lectin Galactoside-Binding Soluble 9 antibody
Cross Reactivity Human
Applications WB
Immunogen LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH
Assay Information LGALS9 Blocking Peptide, catalog no. 33R-10199, is also available for use as a blocking control in assays to test for specificity of this LGALS9 antibody


Western Blot analysis using LGALS9 antibody (70R-5743)

LGALS9 antibody (70R-5743) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LGALS9 antibody (70R-5743) | LGALS9 antibody (70R-5743) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors