LGICZ1 antibody (70R-5201)

Rabbit polyclonal LGICZ1 antibody raised against the N terminal Of Lgicz1

Synonyms Polyclonal LGICZ1 antibody, Anti-LGICZ1 antibody, LGICZ 1, LGICZ-1 antibody, LGICZ 1 antibody, LGICZ antibody, L2 antibody, LGICZ1, ZAC antibody, LGICZ-1, MGC129841 antibody
Specificity LGICZ1 antibody was raised against the N terminal Of Lgicz1
Cross Reactivity Human
Applications WB
Immunogen LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM
Assay Information LGICZ1 Blocking Peptide, catalog no. 33R-7358, is also available for use as a blocking control in assays to test for specificity of this LGICZ1 antibody

Images

Western Blot analysis using LGICZ1 antibody (70R-5201)

LGICZ1 antibody (70R-5201) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGICZ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LGICZ1 antibody (70R-5201) | LGICZ1 antibody (70R-5201) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors