LHPP antibody (70R-4027)

Rabbit polyclonal LHPP antibody raised against the middle region of LHPP

Synonyms Polyclonal LHPP antibody, Anti-LHPP antibody, MGC117251 antibody, MGC142191 antibody, Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase antibody, MGC142189 antibody
Specificity LHPP antibody was raised against the middle region of LHPP
Cross Reactivity Human
Applications WB
Immunogen LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Assay Information LHPP Blocking Peptide, catalog no. 33R-1067, is also available for use as a blocking control in assays to test for specificity of this LHPP antibody

Images

Western Blot analysis using LHPP antibody (70R-4027)

LHPP antibody (70R-4027) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LHPP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LHPP protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LHPP antibody (70R-4027) | LHPP antibody (70R-4027) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors