LIM2 antibody (70R-7174)

Rabbit polyclonal LIM2 antibody raised against the N terminal of LIM2

Synonyms Polyclonal LIM2 antibody, Anti-LIM2 antibody, MP19 antibody, LIM 2 antibody, LIM-2 antibody, LIM2, Lens Intrinsic Membrane Protein 2 19Kda antibody, LIM 2, LIM-2
Specificity LIM2 antibody was raised against the N terminal of LIM2
Cross Reactivity Human
Applications WB
Immunogen LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY
Assay Information LIM2 Blocking Peptide, catalog no. 33R-3559, is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody


Western Blot analysis using LIM2 antibody (70R-7174)

LIM2 antibody (70R-7174) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIM2 antibody (70R-7174) | LIM2 antibody (70R-7174) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors