LIN37 antibody (70R-3840)

Rabbit polyclonal LIN37 antibody

Synonyms Polyclonal LIN37 antibody, Anti-LIN37 antibody, MGC9505 antibody, lin-37 antibody, LIN 37 antibody, LIN37, Lin-37 Homolog antibody, LIN-37 antibody, ZK418.4 antibody, LIN 37, F25965 antibody, LIN-37
Cross Reactivity Human
Applications WB
Immunogen LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
Assay Information LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody


Western Blot analysis using LIN37 antibody (70R-3840)

LIN37 antibody (70R-3840) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIN37 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein expressed in the eye.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIN37 antibody (70R-3840) | LIN37 antibody (70R-3840) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors