LINGO4 antibody (70R-6498)

Rabbit polyclonal LINGO4 antibody raised against the middle region of LINGO4

Synonyms Polyclonal LINGO4 antibody, Anti-LINGO4 antibody, LINGO4, LINGO-4 antibody, LINGO-4, LINGO 4 antibody, LRRN6D antibody, DAAT9248 antibody, PRO34002 antibody, LINGO 4, Leucine Rich Repeat And Ig Domain Containing 4 antibody
Specificity LINGO4 antibody was raised against the middle region of LINGO4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT
Assay Information LINGO4 Blocking Peptide, catalog no. 33R-9169, is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody

Images

Western Blot analysis using LINGO4 antibody (70R-6498)

LINGO4 antibody (70R-6498) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LINGO4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LINGO4 antibody (70R-6498) | LINGO4 antibody (70R-6498) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors