Lipase antibody (Gastric) (70R-5368)

Rabbit polyclonal Lipase antibody (Gastric) raised against the N terminal of LIPF

Synonyms Polyclonal Lipase antibody (Gastric), Anti-Lipase antibody (Gastric), MGC138477 antibody, HLAL antibody, LIPF antibody, GL antibody, HGL antibody, Lipase Gastric antibody, MGC142271 antibody
Specificity Lipase antibody (Gastric) was raised against the N terminal of LIPF
Cross Reactivity Human
Applications WB
Immunogen Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH
Assay Information Lipase Blocking Peptide (Gastric), catalog no. 33R-4163, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Gastric)

Images

Western Blot analysis using Lipase antibody (Gastric) (70R-5368)

Lipase antibody (Gastric) (70R-5368) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIPF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lipase antibody (Gastric) (70R-5368) | Lipase antibody (Gastric) (70R-5368) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors