Lipase antibody (Pancreatic) (70R-1583)

Rabbit polyclonal Lipase antibody (Pancreatic) raised against the C terminal of PNLIP

Synonyms Polyclonal Lipase antibody (Pancreatic), Anti-Lipase antibody (Pancreatic), PNLIP antibody, Pancreatic Lipase antibody
Specificity Lipase antibody (Pancreatic) was raised against the C terminal of PNLIP
Cross Reactivity Human
Applications WB
Immunogen Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
Assay Information Lipase Blocking Peptide (Pancreatic), catalog no. 33R-8469, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Pancreatic)


Western Blot analysis using Lipase antibody (Pancreatic) (70R-1583)

Lipase antibody (Pancreatic) (70R-1583) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PNLIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNLIP is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Lipase antibody (Pancreatic) (70R-1583) | Lipase antibody (Pancreatic) (70R-1583) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors