Lipase J antibody (70R-4117)

Rabbit polyclonal Lipase J antibody raised against the C terminal of LIPJ

Synonyms Polyclonal Lipase J antibody, Anti-Lipase J antibody, LIPL1 antibody, FLJ11218 antibody, bA425M17.2 antibody, Lipase Family Member J antibody, LIPJ antibody
Specificity Lipase J antibody was raised against the C terminal of LIPJ
Cross Reactivity Human
Applications WB
Immunogen Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
Assay Information Lipase J Blocking Peptide, catalog no. 33R-5229, is also available for use as a blocking control in assays to test for specificity of this Lipase J antibody

Images

Western Blot analysis using Lipase J antibody (70R-4117)

Lipase J antibody (70R-4117) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIPJ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lipase J antibody (70R-4117) | Lipase J antibody (70R-4117) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors