LIPI antibody (70R-3577)

Rabbit polyclonal LIPI antibody raised against the middle region of LIPI

Synonyms Polyclonal LIPI antibody, Anti-LIPI antibody, Lipase Member I antibody, LPDL antibody, PRED5 antibody
Specificity LIPI antibody was raised against the middle region of LIPI
Cross Reactivity Human
Applications WB
Immunogen LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL
Assay Information LIPI Blocking Peptide, catalog no. 33R-10099, is also available for use as a blocking control in assays to test for specificity of this LIPI antibody


Western Blot analysis using LIPI antibody (70R-3577)

LIPI antibody (70R-3577) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIPI antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a phospholipase that hydrolyzes phosphatidic acid to produce lysophosphatidic acid. The encoded protein, which can be inhibited by sodium vanadate, may be found exclusively in sperm. Defects in this gene are a cause of susceptibility to familial hypertrigliceridemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIPI antibody (70R-3577) | LIPI antibody (70R-3577) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors