Lipocalin 1 antibody (70R-5914)

Rabbit polyclonal Lipocalin 1 antibody

Synonyms Polyclonal Lipocalin 1 antibody, Anti-Lipocalin 1 antibody, Lipocalin 1, Lipocalin 1 antibody, PMFA antibody, Lipocalin -1, TP antibody, VEGP antibody, Tear Prealbumin antibody, MGC71975 antibody, LCN1 antibody, Lipocalin 1, Lipocalin -1 antibody
Cross Reactivity Human
Applications WB
Immunogen Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
Assay Information Lipocalin 1 Blocking Peptide, catalog no. 33R-4140, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 1 antibody

Images

Western Blot analysis using Lipocalin 1 antibody (70R-5914)

Lipocalin 1 antibody (70R-5914) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lipocalin 1 antibody (70R-5914) | Lipocalin 1 antibody (70R-5914) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors