Lipocalin 6 antibody (70R-5395)

Rabbit polyclonal Lipocalin 6 antibody raised against the middle region of LCN6

Synonyms Polyclonal Lipocalin 6 antibody, Anti-Lipocalin 6 antibody, Lipocalin -6, Lipocalin 6 antibody, Lipocalin 6, UNQ643 antibody, Lipocalin 6, LCN5 antibody, hLcn5 antibody, LCN6 antibody, Lipocalin -6 antibody
Specificity Lipocalin 6 antibody was raised against the middle region of LCN6
Cross Reactivity Human
Applications WB
Immunogen Lipocalin 6 antibody was raised using the middle region of LCN6 corresponding to a region with amino acids LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR
Assay Information Lipocalin 6 Blocking Peptide, catalog no. 33R-5559, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 6 antibody


Western Blot analysis using Lipocalin 6 antibody (70R-5395)

Lipocalin 6 antibody (70R-5395) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LCN6 may play a role in male fertility.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Lipocalin 6 antibody (70R-5395) | Lipocalin 6 antibody (70R-5395) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors