LMAN1 antibody (70R-7295)

Rabbit polyclonal LMAN1 antibody raised against the N terminal of LMAN1

Synonyms Polyclonal LMAN1 antibody, Anti-LMAN1 antibody, LMAN 1, F5F8D antibody, Lectin Mannose-Binding 1 antibody, ERGIC-53 antibody, ERGIC53 antibody, LMAN 1 antibody, LMAN-1 antibody, gp58 antibody, MR60 antibody, LMAN1, FMFD1 antibody, LMAN-1, MCFD1 antibody
Specificity LMAN1 antibody was raised against the N terminal of LMAN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LMAN1 antibody was raised using the N terminal of LMAN1 corresponding to a region with amino acids DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS
Assay Information LMAN1 Blocking Peptide, catalog no. 33R-2095, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody

Images

Western Blot analysis using LMAN1 antibody (70R-7295)

LMAN1 antibody (70R-7295) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMAN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LMAN1 antibody (70R-7295) | LMAN1 antibody (70R-7295) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors