LMF1 antibody (70R-7300)

Rabbit polyclonal LMF1 antibody raised against the N terminal of LMF1

Synonyms Polyclonal LMF1 antibody, Anti-LMF1 antibody, FLJ12681 antibody, C16orf26 antibody, TMEM112 antibody, LMF-1, LMF1, JFP11 antibody, Lipase Maturation Factor 1 antibody, LMF 1, FLJ22302 antibody, TMEM112A antibody, LMF 1 antibody, LMF-1 antibody, HMFN1876 antibody
Specificity LMF1 antibody was raised against the N terminal of LMF1
Cross Reactivity Human
Applications WB
Immunogen LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW
Assay Information LMF1 Blocking Peptide, catalog no. 33R-6372, is also available for use as a blocking control in assays to test for specificity of this LMF1 antibody

Images

Western Blot analysis using LMF1 antibody (70R-7300)

LMF1 antibody (70R-7300) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LMF1 antibody (70R-7300) | LMF1 antibody (70R-7300) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors