LMF2 antibody (70R-6271)

Rabbit polyclonal LMF2 antibody raised against the middle region of LMF2

Synonyms Polyclonal LMF2 antibody, Anti-LMF2 antibody, LMF-2, LMF-2 antibody, LMF 2, LMF2, TMEM153 antibody, TMEM112B antibody, Lipase Maturation Factor 2 antibody, LMF 2 antibody
Specificity LMF2 antibody was raised against the middle region of LMF2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS
Assay Information LMF2 Blocking Peptide, catalog no. 33R-10273, is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody

Images

Western Blot analysis using LMF2 antibody (70R-6271)

LMF2 antibody (70R-6271) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LMF2 antibody (70R-6271) | LMF2 antibody (70R-6271) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors