LNX1 antibody (70R-1566)

Rabbit polyclonal LNX1 antibody raised against the C terminal of LNX1

Synonyms Polyclonal LNX1 antibody, Anti-LNX1 antibody, Ligand Of Numb-Protein X 1 antibody, LNX antibody, MPDZ antibody, LNX-1 antibody, LNX-1, LNX 1, LNX1, LNX 1 antibody, PDZRN2 antibody
Specificity LNX1 antibody was raised against the C terminal of LNX1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
Assay Information LNX1 Blocking Peptide, catalog no. 33R-8514, is also available for use as a blocking control in assays to test for specificity of this LNX1 antibody

Images

Western Blot analysis using LNX1 antibody (70R-1566)

LNX1 antibody (70R-1566) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LNX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LNX1 antibody (70R-1566) | LNX1 antibody (70R-1566) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors