LOC116236 antibody (70R-7482)

Rabbit polyclonal LOC116236 antibody raised against the N terminal of LOC116236

Synonyms Polyclonal LOC116236 antibody, Anti-LOC116236 antibody, LOC116236, LOC-116236, LOC-116236 antibody, Hypothetical Protein Loc116236 antibody, LOC 116236 antibody, LOC 116236
Specificity LOC116236 antibody was raised against the N terminal of LOC116236
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LOC116236 antibody was raised using the N terminal of LOC116236 corresponding to a region with amino acids QTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRITSAGGL
Assay Information LOC116236 Blocking Peptide, catalog no. 33R-7756, is also available for use as a blocking control in assays to test for specificity of this LOC116236 antibody

Images

Western Blot analysis using LOC116236 antibody (70R-7482)

LOC116236 antibody (70R-7482) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC116236 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC116236 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC116236 antibody (70R-7482) | LOC116236 antibody (70R-7482) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors