LOC152586 antibody (70R-4552)

Rabbit polyclonal LOC152586 antibody raised against the middle region of LOC152586

Synonyms Polyclonal LOC152586 antibody, Anti-LOC152586 antibody, LOC 152586, Glycosyltransferase 54 Domain-Containing Protein antibody, LOC-152586, MGC43429 antibody, LOC-152586 antibody, LOC 152586 antibody, LOC152586
Specificity LOC152586 antibody was raised against the middle region of LOC152586
Cross Reactivity Human
Applications WB
Immunogen LOC152586 antibody was raised using the middle region of LOC152586 corresponding to a region with amino acids KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF
Assay Information LOC152586 Blocking Peptide, catalog no. 33R-4586, is also available for use as a blocking control in assays to test for specificity of this LOC152586 antibody


Western Blot analysis using LOC152586 antibody (70R-4552)

LOC152586 antibody (70R-4552) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC152586 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC152586 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC152586 antibody (70R-4552) | LOC152586 antibody (70R-4552) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors