LOC161247 antibody (70R-7083)

Rabbit polyclonal LOC161247 antibody raised against the middle region of Loc161247

Synonyms Polyclonal LOC161247 antibody, Anti-LOC161247 antibody, LOC 161247, LOC-161247 antibody, LOC161247, MGC46490 antibody, LOC 161247 antibody, LOC-161247
Specificity LOC161247 antibody was raised against the middle region of Loc161247
Cross Reactivity Human
Applications WB
Immunogen LOC161247 antibody was raised using the middle region of Loc161247 corresponding to a region with amino acids YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH
Assay Information LOC161247 Blocking Peptide, catalog no. 33R-10094, is also available for use as a blocking control in assays to test for specificity of this LOC161247 antibody

Images

Western Blot analysis using LOC161247 antibody (70R-7083)

LOC161247 antibody (70R-7083) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC161247 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FIT1 (LOC161247) belongs to an evolutionarily conserved family of proteins involved in fat storage.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC161247 antibody (70R-7083) | LOC161247 antibody (70R-7083) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors