LOC201725 antibody (70R-3360)

Rabbit polyclonal LOC201725 antibody raised against the middle region of LOC201725

Synonyms Polyclonal LOC201725 antibody, Anti-LOC201725 antibody, LOC201725, LOC-201725, LOC 201725, LOC-201725 antibody, Hypothetical Protein Loc201725 antibody, LOC 201725 antibody
Specificity LOC201725 antibody was raised against the middle region of LOC201725
Cross Reactivity Human
Applications WB
Immunogen LOC201725 antibody was raised using the middle region of LOC201725 corresponding to a region with amino acids VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL
Assay Information LOC201725 Blocking Peptide, catalog no. 33R-9811, is also available for use as a blocking control in assays to test for specificity of this LOC201725 antibody

Images

Western Blot analysis using LOC201725 antibody (70R-3360)

LOC201725 antibody (70R-3360) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC201725 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of LOC201725 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC201725 antibody (70R-3360) | LOC201725 antibody (70R-3360) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors