LOC202134 antibody (70R-3243)

Rabbit polyclonal LOC202134 antibody raised against the middle region of Loc202134

Synonyms Polyclonal LOC202134 antibody, Anti-LOC202134 antibody, LOC202134, LOC 202134 antibody, LOC-202134, LOC 202134, DKFZp434D115 antibody, LOC-202134 antibody
Specificity LOC202134 antibody was raised against the middle region of Loc202134
Cross Reactivity Human
Applications WB
Immunogen LOC202134 antibody was raised using the middle region of Loc202134 corresponding to a region with amino acids GDLEDLEEHVPGQTVSEEATGVHMMQVDPATPAKSDLEDLEEHVPGQTVS
Assay Information LOC202134 Blocking Peptide, catalog no. 33R-3201, is also available for use as a blocking control in assays to test for specificity of this LOC202134 antibody


Western Blot analysis using LOC202134 antibody (70R-3243)

LOC202134 antibody (70R-3243) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC202134 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC202134 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC202134 antibody (70R-3243) | LOC202134 antibody (70R-3243) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors