LOC221091 antibody (70R-7040)

Rabbit polyclonal LOC221091 antibody raised against the middle region of Loc221091

Synonyms Polyclonal LOC221091 antibody, Anti-LOC221091 antibody, LOC221091, LOC 221091, LOC-221091 antibody, LOC-221091, LOC 221091 antibody, MGC61707 antibody
Specificity LOC221091 antibody was raised against the middle region of Loc221091
Cross Reactivity Human, Mouse
Applications WB
Immunogen LOC221091 antibody was raised using the middle region of Loc221091 corresponding to a region with amino acids PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA
Assay Information LOC221091 Blocking Peptide, catalog no. 33R-7088, is also available for use as a blocking control in assays to test for specificity of this LOC221091 antibody

Images

Western Blot analysis using LOC221091 antibody (70R-7040)

LOC221091 antibody (70R-7040) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC221091 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC221091 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC221091 antibody (70R-7040) | LOC221091 antibody (70R-7040) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors