LOC339879 antibody (70R-1086)

Rabbit polyclonal LOC339879 antibody raised against the C terminal of LOC339879

Synonyms Polyclonal LOC339879 antibody, Anti-LOC339879 antibody, LOC-339879 antibody, LOC-339879, LOC339879, LOC 339879, LOC 339879 antibody, Hypothetical Loc339879 antibody
Specificity LOC339879 antibody was raised against the C terminal of LOC339879
Cross Reactivity Human
Applications WB
Immunogen LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL
Assay Information LOC339879 Blocking Peptide, catalog no. 33R-3720, is also available for use as a blocking control in assays to test for specificity of this LOC339879 antibody

Images

Western Blot analysis using LOC339879 antibody (70R-1086)

LOC339879 antibody (70R-1086) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LOC339879 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC339879 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC339879 antibody (70R-1086) | LOC339879 antibody (70R-1086) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors