LOC339977 antibody (70R-6658)

Rabbit polyclonal LOC339977 antibody raised against the middle region of Loc339977

Synonyms Polyclonal LOC339977 antibody, Anti-LOC339977 antibody, LOC-339977 antibody, , LOC 339977, LOC 339977 antibody, LOC-339977, LOC339977
Specificity LOC339977 antibody was raised against the middle region of Loc339977
Cross Reactivity Human
Applications WB
Immunogen LOC339977 antibody was raised using the middle region of Loc339977 corresponding to a region with amino acids ELDPSLSGEITASLCKMLTHAEAQRTGDSKERGGTEQSLWDSQMEFSKER
Assay Information LOC339977 Blocking Peptide, catalog no. 33R-2535, is also available for use as a blocking control in assays to test for specificity of this LOC339977 antibody

Images

Western Blot analysis using LOC339977 antibody (70R-6658)

LOC339977 antibody (70R-6658) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC339977 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC339977 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC339977 antibody (70R-6658) | LOC339977 antibody (70R-6658) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors