LOC387856 antibody (70R-3464)

Rabbit polyclonal LOC387856 antibody raised against the middle region of LOC387856

Synonyms Polyclonal LOC387856 antibody, Anti-LOC387856 antibody, Similar To Expressed Sequence Ai836003 antibody, LOC387856, LOC-387856 antibody, LOC 387856, LOC 387856 antibody, LOC-387856
Specificity LOC387856 antibody was raised against the middle region of LOC387856
Cross Reactivity Human
Applications WB
Immunogen LOC387856 antibody was raised using the middle region of LOC387856 corresponding to a region with amino acids LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG
Assay Information LOC387856 Blocking Peptide, catalog no. 33R-5298, is also available for use as a blocking control in assays to test for specificity of this LOC387856 antibody

Images

Western Blot analysis using LOC387856 antibody (70R-3464)

LOC387856 antibody (70R-3464) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC387856 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC387856 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC387856 antibody (70R-3464) | LOC387856 antibody (70R-3464) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors