LOC388323 antibody (70R-1727)

Rabbit polyclonal LOC388323 antibody raised against the middle region of LOC388323

Synonyms Polyclonal LOC388323 antibody, Anti-LOC388323 antibody, LOC 388323 antibody, LOC-388323 antibody, LOC-388323, LOC388323, Hypothetical Loc388323 antibody, LOC 388323
Specificity LOC388323 antibody was raised against the middle region of LOC388323
Cross Reactivity Human
Applications WB
Immunogen LOC388323 antibody was raised using the middle region of LOC388323 corresponding to a region with amino acids LAAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRV
Assay Information LOC388323 Blocking Peptide, catalog no. 33R-4756, is also available for use as a blocking control in assays to test for specificity of this LOC388323 antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LOC388323 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC388323 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors