LOC388323 antibody (70R-6623)

Rabbit polyclonal LOC388323 antibody raised against the N terminal Of Loc388323

Synonyms Polyclonal LOC388323 antibody, Anti-LOC388323 antibody, , LOC388323, LOC-388323, LOC 388323 antibody, LOC-388323 antibody, LOC 388323
Specificity LOC388323 antibody was raised against the N terminal Of Loc388323
Cross Reactivity Human
Applications WB
Immunogen LOC388323 antibody was raised using the N terminal Of Loc388323 corresponding to a region with amino acids GARSGCGPRAQPCVPGETAPFQVRQESGTLEAPERKQPPCLGPRGMLGRM
Assay Information LOC388323 Blocking Peptide, catalog no. 33R-3170, is also available for use as a blocking control in assays to test for specificity of this LOC388323 antibody

Images

Western Blot analysis using LOC388323 antibody (70R-6623)

LOC388323 antibody (70R-6623) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC388323 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC388323 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC388323 antibody (70R-6623) | LOC388323 antibody (70R-6623) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors