LOC400566 antibody (70R-3361)

Rabbit polyclonal LOC400566 antibody raised against the N terminal of LOC400566

Synonyms Polyclonal LOC400566 antibody, Anti-LOC400566 antibody, Hypothetical Gene Supported By Ak128660 antibody, LOC-400566 antibody, LOC400566, LOC-400566, LOC 400566 antibody, LOC 400566
Specificity LOC400566 antibody was raised against the N terminal of LOC400566
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LOC400566 antibody was raised using the N terminal of LOC400566 corresponding to a region with amino acids VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL
Assay Information LOC400566 Blocking Peptide, catalog no. 33R-9812, is also available for use as a blocking control in assays to test for specificity of this LOC400566 antibody


Western Blot analysis using LOC400566 antibody (70R-3361)

LOC400566 antibody (70R-3361) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC400566 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC400566 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC400566 antibody (70R-3361) | LOC400566 antibody (70R-3361) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors