LOC441956 antibody (70R-1964)

Rabbit polyclonal LOC441956 antibody raised against the N terminal of LOC441956

Synonyms Polyclonal LOC441956 antibody, Anti-LOC441956 antibody, LOC 441956, LOC441956, Similar To Cdna Sequence Bc021523 antibody, LOC 441956 antibody, LOC-441956, LOC-441956 antibody
Specificity LOC441956 antibody was raised against the N terminal of LOC441956
Cross Reactivity Human
Applications WB
Immunogen LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK
Assay Information LOC441956 Blocking Peptide, catalog no. 33R-1418, is also available for use as a blocking control in assays to test for specificity of this LOC441956 antibody

Images

Western Blot analysis using LOC441956 antibody (70R-1964)

LOC441956 antibody (70R-1964) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC441956 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC441956 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC441956 antibody (70R-1964) | LOC441956 antibody (70R-1964) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors