LOC51035 antibody (70R-3269)

Rabbit polyclonal LOC51035 antibody raised against the middle region of LOC51035

Synonyms Polyclonal LOC51035 antibody, Anti-LOC51035 antibody, LOC-51035, Sapk Substrate Protein 1 antibody, LOC 51035, LOC51035, LOC-51035 antibody, LOC 51035 antibody, 2B28 antibody
Specificity LOC51035 antibody was raised against the middle region of LOC51035
Cross Reactivity Human,Mouse
Applications WB
Immunogen LOC51035 antibody was raised using the middle region of LOC51035 corresponding to a region with amino acids RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF
Assay Information LOC51035 Blocking Peptide, catalog no. 33R-7975, is also available for use as a blocking control in assays to test for specificity of this LOC51035 antibody


Western Blot analysis using LOC51035 antibody (70R-3269)

LOC51035 antibody (70R-3269) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC51035 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC51035 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC51035 antibody (70R-3269) | LOC51035 antibody (70R-3269) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors