LOC606495 antibody (70R-4306)

Rabbit polyclonal LOC606495 antibody raised against the N terminal of LOC606495

Synonyms Polyclonal LOC606495 antibody, Anti-LOC606495 antibody, LOC-606495, LOC-606495 antibody, LOC 606495 antibody, LOC 606495, Hypothetical Protein Loc606495 antibody, LOC606495
Specificity LOC606495 antibody was raised against the N terminal of LOC606495
Cross Reactivity Human
Applications WB
Immunogen LOC606495 antibody was raised using the N terminal of LOC606495 corresponding to a region with amino acids KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD
Assay Information LOC606495 Blocking Peptide, catalog no. 33R-4524, is also available for use as a blocking control in assays to test for specificity of this LOC606495 antibody

Images

Western Blot analysis using LOC606495 antibody (70R-4306)

LOC606495 antibody (70R-4306) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC606495 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC606495 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC606495 antibody (70R-4306) | LOC606495 antibody (70R-4306) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors