LOC728864 antibody (70R-6851)

Rabbit polyclonal LOC728864 antibody raised against the N terminal Of Loc728864

Synonyms Polyclonal LOC728864 antibody, Anti-LOC728864 antibody, LOC-728864, LOC-728864 antibody, LOC728864, , LOC 728864, LOC 728864 antibody
Specificity LOC728864 antibody was raised against the N terminal Of Loc728864
Cross Reactivity Human
Applications WB
Immunogen LOC728864 antibody was raised using the N terminal Of Loc728864 corresponding to a region with amino acids MAPLPTSHPSQAQDPHSWPCSPPHTPTKSRTHAHGPAPHLTPQPSPGPTL
Assay Information LOC728864 Blocking Peptide, catalog no. 33R-5712, is also available for use as a blocking control in assays to test for specificity of this LOC728864 antibody

Images

Western Blot analysis using LOC728864 antibody (70R-6851)

LOC728864 antibody (70R-6851) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC728864 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC728864 remains unkonwn.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC728864 antibody (70R-6851) | LOC728864 antibody (70R-6851) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors