LOC729185 antibody (70R-6940)

Rabbit polyclonal LOC729185 antibody raised against the N terminal Of Loc729185

Synonyms Polyclonal LOC729185 antibody, Anti-LOC729185 antibody, LOC-729185 antibody, LOC 729185 antibody, , LOC729185, LOC 729185, LOC-729185
Specificity LOC729185 antibody was raised against the N terminal Of Loc729185
Cross Reactivity Human
Applications WB
Immunogen LOC729185 antibody was raised using the N terminal Of Loc729185 corresponding to a region with amino acids VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG
Assay Information LOC729185 Blocking Peptide, catalog no. 33R-9806, is also available for use as a blocking control in assays to test for specificity of this LOC729185 antibody

Images

Western Blot analysis using LOC729185 antibody (70R-6940)

LOC729185 antibody (70R-6940) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC729185 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of LOC729185 is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC729185 antibody (70R-6940) | LOC729185 antibody (70R-6940) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors