LOC81691 antibody (70R-3957)

Rabbit polyclonal LOC81691 antibody raised against the middle region of LOC81691

Synonyms Polyclonal LOC81691 antibody, Anti-LOC81691 antibody, LOC 81691, DKFZp434J0315 antibody, LOC 81691 antibody, Exonuclease Nef-Sp antibody, LOC-81691 antibody, LOC-81691, LOC81691
Specificity LOC81691 antibody was raised against the middle region of LOC81691
Cross Reactivity Human
Applications WB
Immunogen LOC81691 antibody was raised using the middle region of LOC81691 corresponding to a region with amino acids AEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
Assay Information LOC81691 Blocking Peptide, catalog no. 33R-1128, is also available for use as a blocking control in assays to test for specificity of this LOC81691 antibody


Western Blot analysis using LOC81691 antibody (70R-3957)

LOC81691 antibody (70R-3957) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC81691 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC81691 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC81691 antibody (70R-3957) | LOC81691 antibody (70R-3957) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors