LOC92270 antibody (70R-6828)

Rabbit polyclonal LOC92270 antibody raised against the C terminal of LOC92270

Synonyms Polyclonal LOC92270 antibody, Anti-LOC92270 antibody, LOC-92270, LOC 92270 antibody, LOC-92270 antibody, MGC138396 antibody, Hypothetical Protein Loc92270 antibody, LOC 92270, LOC92270
Specificity LOC92270 antibody was raised against the C terminal of LOC92270
Cross Reactivity Human
Applications WB
Immunogen LOC92270 antibody was raised using the C terminal of LOC92270 corresponding to a region with amino acids LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS
Assay Information LOC92270 Blocking Peptide, catalog no. 33R-5020, is also available for use as a blocking control in assays to test for specificity of this LOC92270 antibody

Images

Western Blot analysis using LOC92270 antibody (70R-6828)

LOC92270 antibody (70R-6828) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC92270 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC92270 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC92270 antibody (70R-6828) | LOC92270 antibody (70R-6828) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors