LONRF2 antibody (70R-6199)

Rabbit polyclonal LONRF2 antibody raised against the middle region of LONRF2

Synonyms Polyclonal LONRF2 antibody, Anti-LONRF2 antibody, MGC126711 antibody, LONRF-2 antibody, LONRF2, LONRF-2, Lon Peptidase N-Terminal Domain And Ring Finger 2 antibody, RNF192 antibody, LONRF 2 antibody, FLJ45273 antibody, MGC126713 antibody, LONRF 2
Specificity LONRF2 antibody was raised against the middle region of LONRF2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR
Assay Information LONRF2 Blocking Peptide, catalog no. 33R-2908, is also available for use as a blocking control in assays to test for specificity of this LONRF2 antibody

Images

Western Blot analysis using LONRF2 antibody (70R-6199)

LONRF2 antibody (70R-6199) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LONRF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LONRF2 antibody (70R-6199) | LONRF2 antibody (70R-6199) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors